Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Microtubule-associated proteins 1A/1B light chain 3B |
|---|
Gene and Protein Information
| Gene ID | 81631 |
|---|---|
| Uniprot Accession IDs | Q9GZQ8 Q6NW02 |
| Ensembl ID | ENSP00000268607 |
| Symbole | MAP1ALC3 LC3B ATG8F MAP1LC3B-a MAP1A/1BLC3 |
| Family | Belongs to the ATG8 family. |
| Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746157 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9598 | Inparanoid, OMA, EggNOG | |
| Dog | 479619 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9615 | OMA, EggNOG | |
| Horse | 100060547 | LOC100060547 | microtubule-associated proteins 1A/1B light chain 3B | 9796 | OMA, EggNOG | |
| Cow | 408001 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100462754 | MAP1LC3B | microtubule associated protein 1 light chain 3 beta | 9823 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394972 | map1lc3b | microtubule associated protein 1 light chain 3 beta | 8364 | XB-GENE-953620 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.