MT-CO2

DescriptionCytochrome c oxidase subunit 2

Gene and Protein Information

Gene ID4513
Uniprot Accession IDs P00403 Q37526
Ensembl ID ENSP00000354876
Symbole COII COX2 COXII MTCO2 COII MTCO2
FamilyBelongs to the cytochrome c oxidase subunit 2 family.
Sequence
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp807864MT-CO2mitochondrially encoded cytochrome c oxidase II9598VGNC:11715Inparanoid, OMA, EggNOG
Macaque2846628COX2cytochrome c oxidase subunit II9544OMA, EggNOG
Mouse17709mt-Co2mitochondrially encoded cytochrome c oxidase II10090MGI:102503Inparanoid, OMA, EggNOG
Rat26198Mt-co2mitochondrially encoded cytochrome c oxidase II10116RGD:621872Inparanoid, OMA, EggNOG
Dog804479MT-CO2mitochondrially encoded cytochrome c oxidase II9615VGNC:53137Inparanoid, OMA, EggNOG
Horse807845COX2cytochrome c oxidase subunit II9796Inparanoid, OMA, EggNOG
Cow3283880COX2cytochrome c oxidase subunit II9913Inparanoid, OMA, EggNOG
Pig808504COX2cytochrome c oxidase subunit II9823Inparanoid, OMA, EggNOG
Opossum3074663COX2cytochrome c oxidase subunit II13616OMA, EggNOG
Platypus808709COX2cytochrome c oxidase subunit II9258Inparanoid, EggNOG
Anole lizard6385975COX2cytochrome c oxidase subunit II28377Inparanoid, OMA, EggNOG
Xenopus3283495COX2cytochrome c oxidase subunit II8364Inparanoid, OMA
Zebrafish140540mt-co2cytochrome c oxidase II, mitochondrial7955ZDB-GENE-011205-15Inparanoid, OMA, EggNOG
C. elegans2565697COX2cytochrome c oxidase subunit II6239Inparanoid, OMA, EggNOG
Fruitfly19893535COX2cytochrome c oxidase subunit II7227FBgn0013675Inparanoid, EggNOG
S.cerevisiae854622COX2cytochrome c oxidase subunit 24932S000007281Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.