Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Ragulator complex protein LAMTOR2 |
|---|
Gene and Protein Information
| Gene ID | 28956 |
|---|---|
| Uniprot Accession IDs | Q9Y2Q5 Q5VY97 Q5VY98 Q5VY99 |
| Ensembl ID | ENSP00000357288 |
| Symbole | MAPBPIP ROBLD3 p14 ENDAP ROBLD3 HSPC003 MAPBPIP MAPKSP1AP Ragulator2 |
| Family | Belongs to the GAMAD family. |
| Sequence | MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107973412 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9598 | VGNC:8350 | Inparanoid, OMA, EggNOG |
| Macaque | 718110 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 83409 | Lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 10090 | MGI:1932697 | Inparanoid, OMA, EggNOG |
| Rat | 295234 | Lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 10116 | RGD:1562501 | Inparanoid, OMA, EggNOG |
| Horse | 100063939 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9796 | VGNC:19575 | Inparanoid, OMA, EggNOG |
| Cow | 616375 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9913 | VGNC:30780 | Inparanoid, OMA, EggNOG |
| Pig | 100156749 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100017683 | LAMTOR2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448570 | lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 8364 | XB-GENE-992364 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445155 | lamtor2 | late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 | 7955 | ZDB-GENE-040801-63 | Inparanoid, OMA, EggNOG |
| C. elegans | 179177 | lmtr-2 | Ragulator complex protein LAMTOR2 homolog | 6239 | Inparanoid, OMA | |
| Fruitfly | 37122 | CG5189 | CG5189 gene product from transcript CG5189-RB | 7227 | FBgn0034350 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.