224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | E-selectin |
|---|
Gene and Protein Information
| Gene ID | 6401 |
|---|---|
| Uniprot Accession IDs | P16581 A2RRD6 P16111 |
| Ensembl ID | ENSP00000331736 |
| Symbole | ELAM1 ELAM ESEL CD62E ELAM1 LECAM2 |
| Family | Belongs to the selectin/LECAM family. |
| Sequence | MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 736063 | SELE | selectin E | 9598 | VGNC:1537 | OMA, EggNOG |
| Macaque | 701538 | SELE | selectin E | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20339 | Sele | selectin, endothelial cell | 10090 | MGI:98278 | Inparanoid, OMA, EggNOG |
| Rat | 25544 | Sele | selectin E | 10116 | RGD:3654 | Inparanoid, OMA, EggNOG |
| Dog | 403999 | SELE | selectin E | 9615 | VGNC:45980 | Inparanoid, OMA, EggNOG |
| Horse | 100033910 | SELE | selectin E | 9796 | VGNC:50882 | Inparanoid, OMA, EggNOG |
| Cow | 281484 | SELE | selectin E | 9913 | VGNC:34421 | Inparanoid, OMA, EggNOG |
| Pig | 397508 | SELE | selectin E | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 103170505 | SELE | selectin E | 9258 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.