🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CA5B

DescriptionCarbonic anhydrase 5B, mitochondrial

Gene and Protein Information

Gene ID11238
Uniprot Accession IDs Q9Y2D0 A8K4T5
Ensembl ID ENSP00000314099
Symbole CAVB CA-VB
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque713128CA5Bcarbonic anhydrase 5B9544Inparanoid, OMA, EggNOG
Mouse56078Car5bcarbonic anhydrase 5b, mitochondrial10090MGI:1926249Inparanoid, OMA, EggNOG
Rat302669Car5bcarbonic anhydrase 5B10116RGD:1549783Inparanoid, OMA, EggNOG
Dog100856271CA5Bcarbonic anhydrase 5B9615VGNC:38613Inparanoid, OMA, EggNOG
Horse100051095LOC100051095carbonic anhydrase 5B, mitochondrial9796OMA, EggNOG
Cow514494CA5Bcarbonic anhydrase 5B9913VGNC:26655Inparanoid, OMA, EggNOG
Pig100156418CA5Bcarbonic anhydrase 5B9823OMA, EggNOG
Opossum100031763CA5Bcarbonic anhydrase 5B13616Inparanoid, OMA, EggNOG
PlatypusCA5Bcarbonic anhydrase 5B [Source:HGNC Symbol;Acc:HGNC:1378]9258OMA, EggNOG
Xenopus733981ca5bcarbonic anhydrase VB, mitochondrial8364XB-GENE-1003819Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.