🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CA6

DescriptionCarbonic anhydrase 6

Gene and Protein Information

Gene ID765
Uniprot Accession IDs P23280 E7EMQ1 Q5FBW3 Q5FC00 Q96QX8 Q9UF03
Ensembl ID ENSP00000366654
Symbole CA-VI GUSTIN
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457915CA6carbonic anhydrase 69598VGNC:9850OMA, EggNOG
Macaque709540CA6carbonic anhydrase 69544OMA, EggNOG
Mouse12353Car6carbonic anhydrase 610090MGI:1333786Inparanoid, OMA, EggNOG
Rat298657Car6carbonic anhydrase 610116RGD:70516Inparanoid, OMA, EggNOG
Dog403503CA6carbonic anhydrase 69615VGNC:38614Inparanoid, OMA, EggNOG
Horse100051818CA6carbonic anhydrase 69796VGNC:15966Inparanoid, OMA, EggNOG
Cow280742CA6carbonic anhydrase 69913VGNC:26656Inparanoid, OMA, EggNOG
Pig100240717CA6carbonic anhydrase 69823Inparanoid, OMA, EggNOG
Opossum100617216CA6carbonic anhydrase 613616Inparanoid, OMA, EggNOG
Xenopus779937ca6carbonic anhydrase 68364XB-GENE-494019Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.