🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CA13

DescriptionCarbonic anhydrase 13

Gene and Protein Information

Gene ID377677
Uniprot Accession IDs Q8N1Q1
Ensembl ID ENSP00000318912
Symbole CAXIII
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp747299CA13carbonic anhydrase 139598VGNC:12000OMA, EggNOG
Mouse71934Car13carbonic anhydrase 1310090MGI:1931322Inparanoid, OMA, EggNOG
Rat499566Car13carbonic anhydrase 1310116RGD:1560453Inparanoid, OMA, EggNOG
Dog487030CA13carbonic anhydrase 139615VGNC:38608Inparanoid, OMA, EggNOG
HorseCA13carbonic anhydrase 13 [Source:HGNC Symbol;Acc:HGNC:14914]9796OMA, EggNOG
Cow513850CA13carbonic anhydrase 139913VGNC:26651Inparanoid, OMA, EggNOG
Pig100152714LOC100152714carbonic anhydrase 139823Inparanoid, OMA, EggNOG
Opossum100018677LOC100018677carbonic anhydrase 1313616OMA, EggNOG
PlatypusCA13carbonic anhydrase 13 [Source:HGNC Symbol;Acc:HGNC:14914]9258OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.