🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CA3

DescriptionCarbonic anhydrase 3

Gene and Protein Information

Gene ID761
Uniprot Accession IDs P07451 B2R867 B3KUC8 O60842
Ensembl ID ENSP00000285381
Symbole Car3 CAIII
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque703801CA3carbonic anhydrase 39544Inparanoid, OMA, EggNOG
Mouse12350Car3carbonic anhydrase 310090MGI:88270Inparanoid, OMA, EggNOG
Rat54232Car3carbonic anhydrase 310116RGD:2241Inparanoid, OMA, EggNOG
Dog487032CA3carbonic anhydrase 39615VGNC:38611Inparanoid, OMA, EggNOG
Horse100050125CA3carbonic anhydrase 39796VGNC:15964Inparanoid, OMA, EggNOG
Cow513212CA3carbonic anhydrase 39913VGNC:26653Inparanoid, OMA, EggNOG
Pig494016CA3carbonic anhydrase 39823Inparanoid, OMA, EggNOG
Opossum100018604CA3carbonic anhydrase 313616Inparanoid, OMA, EggNOG
PlatypusCA3carbonic anhydrase 3 [Source:HGNC Symbol;Acc:HGNC:1374]9258OMA, EggNOG
Xenopus100496328ca3carbonic anhydrase III8364XB-GENE-1007186OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.