Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Cathepsin D |
|---|
Gene and Protein Information
| Gene ID | 1509 |
|---|---|
| Uniprot Accession IDs | P07339 Q6IB57 |
| Ensembl ID | ENSP00000236671 |
| Symbole | CPSD CPSD CLN10 HEL-S-130P |
| Family | Belongs to the peptidase A1 family. |
| Sequence | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 703534 | CTSD | cathepsin D | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13033 | Ctsd | cathepsin D | 10090 | MGI:88562 | Inparanoid, OMA, EggNOG |
| Rat | 171293 | Ctsd | cathepsin D | 10116 | RGD:621511 | Inparanoid, OMA, EggNOG |
| Dog | 483662 | CTSD | cathepsin D | 9615 | Inparanoid, OMA | |
| Cow | 282883 | CTSD | cathepsin D | 9913 | Inparanoid, OMA | |
| Chicken | 396090 | CTSD | cathepsin D | 9031 | CGNC:4989 | Inparanoid, OMA |
| Anole lizard | 100567238 | ctsd | cathepsin D | 28377 | Inparanoid, OMA | |
| Zebrafish | 65225 | ctsd | cathepsin D | 7955 | ZDB-GENE-010131-8 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.