🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CASP6

DescriptionCaspase-6

Gene and Protein Information

Gene ID839
Uniprot Accession IDs P55212 Q9BQE7 CASP-6
Ensembl ID ENSP00000265164
Symbole MCH2 MCH2
FamilyBelongs to the peptidase C14A family.
Sequence
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque698788CASP6caspase 69544OMA, EggNOG
Mouse12368Casp6caspase 610090MGI:1312921Inparanoid, OMA, EggNOG
Rat83584Casp6caspase 610116RGD:70967Inparanoid, OMA
Dog487899CASP6caspase 69615Inparanoid, EggNOG
Horse100072861CASP6caspase 69796VGNC:16069Inparanoid, OMA, EggNOG
Cow538409CASP6caspase 69913VGNC:26782Inparanoid, OMA, EggNOG
Pig100517293CASP6caspase 69823OMA, EggNOG
Opossum100009858CASP6caspase 613616Inparanoid, OMA, EggNOG
PlatypusCASP6caspase 6 [Source:HGNC Symbol;Acc:HGNC:1507]9258OMA, EggNOG
Chicken395477CASP6caspase 69031CGNC:9250Inparanoid, OMA, EggNOG
Anole lizard100564002casp6caspase 628377Inparanoid, OMA, EggNOG
Xenopus496478casp6caspase 68364XB-GENE-482797Inparanoid, OMA, EggNOG
Zebrafish552927casp6caspase 6, apoptosis-related cysteine peptidase7955ZDB-GENE-030825-4Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    protease inhibitor    /    Caspase-6
protein    /    enzyme modulator    /    cysteine protease    /    Caspase-6
protein    /    enzyme modulator    /    protease    /    Caspase-6
protein    /    enzyme modulator    /    hydrolase    /    Caspase-6
DTO Classes
protein    /    Enzyme    /    Protease    /    Cysteine protease    /    Caspase-6

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.