Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Protein arginine N-methyltransferase 5 |
|---|
Gene and Protein Information
| Gene ID | 10419 |
|---|---|
| Uniprot Accession IDs | O14744 A8MTP3 A8MZ91 B4DX49 B4DY30 B5BU10 D3DS33 E2QRE7 Q6IBR1 Q9UKH1 |
| Ensembl ID | ENSP00000319169 |
| Symbole | HRMT1L5 IBP72 JBP1 SKB1 HSL7 JBP1 SKB1 IBP72 SKB1Hs HRMT1L5 |
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family. |
| Sequence | MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452789 | PRMT5 | protein arginine methyltransferase 5 | 9598 | VGNC:3352 | OMA, EggNOG |
| Macaque | 712718 | PRMT5 | protein arginine methyltransferase 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 27374 | Prmt5 | protein arginine N-methyltransferase 5 | 10090 | MGI:1351645 | Inparanoid, OMA, EggNOG |
| Rat | 364382 | Prmt5 | protein arginine methyltransferase 5 | 10116 | RGD:1309053 | Inparanoid, OMA, EggNOG |
| Dog | 480242 | PRMT5 | protein arginine methyltransferase 5 | 9615 | VGNC:44998 | Inparanoid, OMA, EggNOG |
| Horse | 100052729 | PRMT5 | protein arginine methyltransferase 5 | 9796 | VGNC:21862 | Inparanoid, OMA, EggNOG |
| Cow | 515594 | PRMT5 | protein arginine methyltransferase 5 | 9913 | VGNC:33350 | Inparanoid, OMA, EggNOG |
| Pig | 100294711 | PRMT5 | protein arginine methyltransferase 5 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024287 | PRMT5 | protein arginine methyltransferase 5 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100555438 | prmt5 | protein arginine methyltransferase 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145788 | prmt5 | protein arginine methyltransferase 5 | 8364 | XB-GENE-975034 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368664 | prmt5 | protein arginine methyltransferase 5 | 7955 | ZDB-GENE-030616-585 | Inparanoid, OMA, EggNOG |
| C. elegans | 175717 | prmt-5 | Protein arginine N-methyltransferase 5 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36809 | csul | capsuleen | 7227 | FBgn0015925 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 852431 | HSL7 | protein arginine N-methyltransferase | 4932 | S000000337 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.