🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

BAD

DescriptionBcl2-associated agonist of cell death

Gene and Protein Information

Gene ID572
Uniprot Accession IDs Q92934 O14803 Q6FH21 BAD
Ensembl ID ENSP00000378040
Symbole BBC6 BCL2L8 BBC2 BCL2L8
FamilyBelongs to the Bcl-2 family.
Sequence
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp100615623BADBCL2 associated agonist of cell death9598VGNC:1614OMA, EggNOG
Macaque717740BADBCL2 associated agonist of cell death9544Inparanoid, OMA, EggNOG
Mouse12015BadBCL2-associated agonist of cell death10090MGI:1096330Inparanoid, OMA, EggNOG
Rat64639BadBCL2-associated agonist of cell death10116RGD:620103Inparanoid, OMA
Dog483763BADBCL2 associated agonist of cell death9615VGNC:38362Inparanoid, OMA, EggNOG
Horse100055447BADBCL2 associated agonist of cell death9796VGNC:15752Inparanoid, OMA, EggNOG
Cow615013BADBCL2 associated agonist of cell death9913VGNC:26404Inparanoid, OMA, EggNOG
Pig100521065BADBCL2 associated agonist of cell death9823OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.