🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

COX4I1

DescriptionCytochrome c oxidase subunit 4 isoform 1, mitochondrial

Gene and Protein Information

Gene ID1327
Uniprot Accession IDs P13073 B2R4J2 D3DUM7 Q6P666
Ensembl ID ENSP00000457513
Symbole COX4 COX4 COXIV COX4-1 COXIV-1 COX IV-1
FamilyBelongs to the cytochrome c oxidase IV family.
Sequence
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp454391COX4I1cytochrome c oxidase subunit 4I19598VGNC:9043OMA, EggNOG
Macaque693811COX4I1cytochrome c oxidase subunit IV isoform 19544OMA, EggNOG
Mouse12857Cox4i1cytochrome c oxidase subunit 4I110090MGI:88473Inparanoid, OMA, EggNOG
Rat29445Cox4i1cytochrome c oxidase subunit 4i110116RGD:68374Inparanoid, OMA, EggNOG
Dog479623COX4I1cytochrome c oxidase subunit 4I19615VGNC:39539Inparanoid, OMA, EggNOG
Horse100056171COX4I1cytochrome c oxidase subunit 4I19796VGNC:16801Inparanoid, OMA, EggNOG
Cow281090COX4I1cytochrome c oxidase subunit 4I19913VGNC:27634Inparanoid, OMA, EggNOG
Pig100624067LOC100624067cytochrome c oxidase subunit 4 isoform 1, mitochondrial9823Inparanoid, OMA, EggNOG
Platypus100076685LOC100076685cytochrome c oxidase subunit 4 isoform 1, mitochondrial9258OMA, EggNOG
Chicken415826COX4I1cytochrome c oxidase subunit 4I19031CGNC:4285Inparanoid, OMA
Anole lizard100552415LOC100552415cytochrome c oxidase subunit 4 isoform 1, mitochondrial28377OMA, EggNOG
Xenopus549233cox4i1cytochrome c oxidase subunit IV isoform 18364XB-GENE-953648Inparanoid, OMA, EggNOG
Zebrafish326975cox4i1cytochrome c oxidase subunit IV isoform 17955ZDB-GENE-030131-5175Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.