Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Cytochrome c oxidase assembly protein COX11, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1353 |
|---|---|
| Uniprot Accession IDs | Q9Y6N1 D3DTY5 I3L220 Q6FHB7 Q9BRX0 Q9UME8 |
| Ensembl ID | ENSP00000299335 |
| Symbole | COX11P |
| Family | Belongs to the COX11/CtaG family. |
| Sequence | MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748332 | COX11 | COX11, cytochrome c oxidase copper chaperone | 9598 | VGNC:12146 | OMA, EggNOG |
| Macaque | 641445 | COX11 | COX11 homolog, cytochrome c oxidase assembly protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 69802 | Cox11 | cytochrome c oxidase assembly protein 11 | 10090 | MGI:1917052 | Inparanoid, OMA, EggNOG |
| Dog | 609555 | COX11 | COX11 cytochrome c oxidase assembly homolog (yeast) | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100056543 | COX11 | COX11, cytochrome c oxidase copper chaperone | 9796 | VGNC:51473 | Inparanoid, OMA, EggNOG |
| Cow | 510509 | COX11 | COX11 cytochrome c oxidase assembly homolog (yeast) | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014890 | LOC100014890 | cytochrome c oxidase assembly protein COX11, mitochondrial | 13616 | OMA, EggNOG | |
| Chicken | 770638 | COX11 | COX11, cytochrome c oxidase copper chaperone | 9031 | CGNC:66650 | Inparanoid, OMA |
| Anole lizard | 100566567 | LOC100566567 | cytochrome c oxidase assembly protein COX11, mitochondrial | 28377 | OMA, EggNOG | |
| Xenopus | cox11 | COX11 cytochrome c oxidase copper chaperone [Source:Xenbase;Acc:XB-GENE-6048797] | 8364 | OMA, EggNOG | ||
| Zebrafish | 100005158 | cox11 | cytochrome c oxidase assembly homolog 11 (yeast) | 7955 | ZDB-GENE-050506-82 | Inparanoid, OMA, EggNOG |
| C. elegans | 186814 | cox-11 | Cytochrome OXidase assembly protein | 6239 | Inparanoid, OMA | |
| Fruitfly | 33776 | CG31648 | CG31648 gene product from transcript CG31648-RA | 7227 | FBgn0051648 | Inparanoid, EggNOG |
| S.cerevisiae | 855971 | COX11 | Cox11p | 4932 | S000006053 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.