🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CYSLTR1

DescriptionCysteinyl leukotriene receptor 1

Gene and Protein Information

Gene ID10800
Uniprot Accession IDs Q9Y271 B2R954 D3DTE4 Q5JS94 Q8IV19 CysLTR1
Ensembl ID ENSP00000478492
Symbole CYSLT1 CYSLT1 CYSLTR CYSLT1R HMTMF81
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque706663CYSLTR1cysteinyl leukotriene receptor 19544Inparanoid, OMA, EggNOG
Mouse58861Cysltr1cysteinyl leukotriene receptor 110090MGI:1926218Inparanoid, OMA, EggNOG
Rat114099Cysltr1cysteinyl leukotriene receptor 110116RGD:619796Inparanoid, OMA, EggNOG
Dog100686426CYSLTR1cysteinyl leukotriene receptor 19615VGNC:50295Inparanoid, OMA, EggNOG
Horse100072636CYSLTR1cysteinyl leukotriene receptor 19796VGNC:50471Inparanoid, OMA, EggNOG
Cow782045CYSLTR1cysteinyl leukotriene receptor 19913Inparanoid, OMA, EggNOG
Opossum103101601CYSLTR1cysteinyl leukotriene receptor 113616Inparanoid, OMA, EggNOG
ChickenCYSLTR1cysteinyl leukotriene receptor 1 [Source:HGNC Symbol;Acc:HGNC:17451]9031OMA, EggNOG
Anole lizardCYSLTR1cysteinyl leukotriene receptor 1 [Source:HGNC Symbol;Acc:HGNC:17451]28377Inparanoid, OMA, EggNOG
Xenopuscysltr1cysteinyl leukotriene receptor 1 [Source:Xenbase;Acc:XB-GENE-1012699]8364OMA, EggNOG
Zebrafish553675cysltr1cysteinyl leukotriene receptor 17955ZDB-GENE-050522-250Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Cysteinyl leukotriene receptor 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Leukotriene receptor    /    Cysteinyl leukotriene receptor 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.