Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Aurora kinase C |
|---|
Gene and Protein Information
| Gene ID | 6795 |
|---|---|
| Uniprot Accession IDs | Q9UQB9 O60681 O75442 Q6AZY8 Q6DLZ0 Q9UPK5 |
| Ensembl ID | ENSP00000302898 |
| Symbole | AIE2 AIK3 AIRK3 ARK3 STK13 AIE2 AIK3 ARK3 AurC SPGF5 STK13 HEL-S-90 aurora-C |
| Family | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily. |
| Sequence | MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740217 | AURKC | aurora kinase C | 9598 | VGNC:2099 | OMA, EggNOG |
| Macaque | 709801 | AURKC | aurora kinase C | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20871 | Aurkc | aurora kinase C | 10090 | MGI:1321119 | Inparanoid, OMA |
| Dog | 102155400 | AURKC | aurora kinase C | 9615 | VGNC:38313 | Inparanoid, OMA |
| Horse | 100051177 | AURKC | aurora kinase C | 9796 | VGNC:15705 | Inparanoid, OMA |
| Cow | 618599 | AURKC | aurora kinase C | 9913 | Inparanoid, OMA | |
| C. elegans | 172268 | air-2 | Aurora/IPL1-related protein kinase 2 | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 855892 | IPL1 | aurora kinase | 4932 | S000006130 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.