🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

SLC7A11

DescriptionCystine/glutamate transporter

Gene and Protein Information

Gene ID23657
Uniprot Accession IDs Q9UPY5 A8K2U4
Ensembl ID ENSP00000280612
Symbole xCT CCBR1
FamilyBelongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp471310SLC7A11solute carrier family 7 member 119598VGNC:50362OMA, EggNOG
Macaque696516SLC7A11solute carrier family 7 member 119544Inparanoid, OMA, EggNOG
Mouse26570Slc7a11solute carrier family 7 (cationic amino acid transporter, y+ system), member 1110090MGI:1347355Inparanoid, OMA, EggNOG
Rat310392Slc7a11solute carrier family 7 member 1110116RGD:1309275Inparanoid, OMA, EggNOG
Dog483821SLC7A11solute carrier family 7 member 119615VGNC:46472Inparanoid, OMA, EggNOG
Horse100063433SLC7A11solute carrier family 7 member 119796VGNC:23267Inparanoid, OMA, EggNOG
Cow524078SLC7A11solute carrier family 7 member 119913VGNC:34926Inparanoid, OMA, EggNOG
Opossum100027770SLC7A11solute carrier family 7 member 1113616Inparanoid, OMA, EggNOG
Chicken428731SLC7A11solute carrier family 7 member 119031CGNC:7416Inparanoid, OMA, EggNOG
Xenopusslc7a11solute carrier family 7 member 11 [Source:Xenbase;Acc:XB-GENE-960114]8364OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC3 and SLC7 families of heteromeric amino acid transporters (HATs)    /    SLC7 family    /    Cystine/glutamate transporter

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.