🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PFKFB2

Description6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2

Gene and Protein Information

Gene ID5208
Uniprot Accession IDs O60825 O60824 Q5VVQ3 Q5VVQ4 Q9H3P1 6PF-2-K/Fru-2,6-P2ase 2
Ensembl ID ENSP00000356047
Symbole PFK-2/FBPase-2
FamilyIn the C-terminal section; belongs to the phosphoglycerate mutase family.
Sequence
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457687PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29598VGNC:8091OMA, EggNOG
Macaque693509PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29544Inparanoid, OMA, EggNOG
Mouse18640Pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 210090MGI:107815Inparanoid, OMA, EggNOG
Rat24640Pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 210116RGD:3309Inparanoid, OMA, EggNOG
Dog480011PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29615VGNC:44443Inparanoid, OMA
Horse100051146PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29796VGNC:21338Inparanoid, OMA
Cow287019PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29913VGNC:32770Inparanoid, OMA
Opossum100020159PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 213616Inparanoid, OMA
Chicken419850PFKFB26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 29031CGNC:758Inparanoid, OMA
Anole lizard100563872pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 228377Inparanoid, OMA
Xenopus100170160pfkfb26-phosphofructo-2-kinase/fructose-2,6-biphosphatase 28364XB-GENE-981174Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.