Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Voltage-dependent anion-selective channel protein 2 |
|---|
Gene and Protein Information
| Gene ID | 7417 |
|---|---|
| Uniprot Accession IDs | P45880 Q5VWK1 Q5VWK3 Q6IB40 Q7L3J5 Q9BWK8 Q9Y5I6 VDAC-2 |
| Ensembl ID | ENSP00000361635 |
| Symbole | POR |
| Family | Belongs to the eukaryotic mitochondrial porin family. |
| Sequence | MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471721 | LOC471721 | voltage-dependent anion-selective channel protein 2 | 9598 | OMA, EggNOG | |
| Macaque | 704257 | VDAC2 | voltage dependent anion channel 2 | 9544 | Inparanoid, OMA | |
| Mouse | 22334 | Vdac2 | voltage-dependent anion channel 2 | 10090 | MGI:106915 | Inparanoid, OMA, EggNOG |
| Rat | 83531 | Vdac2 | voltage-dependent anion channel 2 | 10116 | RGD:621576 | Inparanoid, OMA, EggNOG |
| Dog | 479255 | VDAC2 | voltage dependent anion channel 2 | 9615 | VGNC:48247 | Inparanoid, OMA, EggNOG |
| Horse | 100064276 | VDAC2 | voltage dependent anion channel 2 | 9796 | VGNC:24896 | Inparanoid, OMA, EggNOG |
| Cow | 282120 | VDAC2 | voltage dependent anion channel 2 | 9913 | VGNC:36783 | Inparanoid, OMA, EggNOG |
| Pig | 397659 | VDAC2 | voltage dependent anion channel 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012461 | VDAC2 | voltage dependent anion channel 2 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100075011 | VDAC2 | voltage dependent anion channel 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 395498 | VDAC2 | voltage dependent anion channel 2 | 9031 | CGNC:49348 | Inparanoid, OMA |
| Anole lizard | 100565441 | vdac2 | voltage dependent anion channel 2 | 28377 | Inparanoid, OMA | |
| Xenopus | 548947 | vdac2 | voltage-dependent anion channel 2 | 8364 | XB-GENE-954839 | Inparanoid, OMA |
| Zebrafish | 322126 | vdac2 | voltage-dependent anion channel 2 | 7955 | ZDB-GENE-030131-845 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.