🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

HTR5A

Description5-hydroxytryptamine receptor 5A

Gene and Protein Information

Gene ID3361
Uniprot Accession IDs P47898 Q2M2D2 5-HT-5
Ensembl ID ENSP00000287907
Symbole 5-HT5A
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp463837HTR5A5-hydroxytryptamine receptor 5A9598VGNC:8691OMA, EggNOG
Macaque716134HTR5A5-hydroxytryptamine receptor 5A9544Inparanoid, OMA, EggNOG
Mouse15563Htr5a5-hydroxytryptamine (serotonin) receptor 5A10090MGI:96283Inparanoid, OMA, EggNOG
Rat25689Htr5a5-hydroxytryptamine receptor 5A10116RGD:2851Inparanoid, OMA, EggNOG
Dog482814HTR5A5-hydroxytryptamine receptor 5A9615VGNC:41832Inparanoid, OMA, EggNOG
Horse100063709HTR5A5-hydroxytryptamine receptor 5A9796VGNC:18908Inparanoid, OMA
Cow541200HTR5A5-hydroxytryptamine receptor 5A9913VGNC:30001Inparanoid, OMA
Pig100154782LOC1001547825-hydroxytryptamine receptor 5B9823Inparanoid, EggNOG
OpossumHTR5A5-hydroxytryptamine receptor 5A [Source:HGNC Symbol;Acc:HGNC:5300]13616OMA, EggNOG
Chicken428409HTR5A5-hydroxytryptamine receptor 5A9031CGNC:53358Inparanoid, OMA, EggNOG
Anole lizard100556449htr5a5-hydroxytryptamine receptor 5A28377Inparanoid, OMA, EggNOG
Xenopushtr5a5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled [Source:Xenbase;Acc:XB-GENE-981825]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    5-hydroxytryptamine receptor 5a
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    5-hydroxytryptamine receptor    /    5-HT5 receptor    /    5-hydroxytryptamine receptor 5a

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.