Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Muscarinic acetylcholine receptor M5 |
|---|
Gene and Protein Information
| Gene ID | 1133 |
|---|---|
| Uniprot Accession IDs | P08912 Q96RG7 |
| Ensembl ID | ENSP00000372750 |
| Symbole | HM5 |
| Family | Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM5 sub-subfamily. |
| Sequence | MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 503515 | CHRM5 | cholinergic receptor muscarinic 5 | 9598 | VGNC:10166 | Inparanoid, OMA, EggNOG |
| Macaque | 574330 | CHRM5 | cholinergic receptor muscarinic 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 213788 | Chrm5 | cholinergic receptor, muscarinic 5 | 10090 | MGI:109248 | Inparanoid, OMA, EggNOG |
| Rat | 53949 | Chrm5 | cholinergic receptor, muscarinic 5 | 10116 | RGD:620027 | Inparanoid, OMA, EggNOG |
| Dog | 487472 | CHRM5 | cholinergic receptor muscarinic 5 | 9615 | VGNC:39235 | Inparanoid, OMA |
| Horse | 100057856 | CHRM5 | cholinergic receptor muscarinic 5 | 9796 | VGNC:16521 | Inparanoid, OMA |
| Cow | 281686 | CHRM5 | cholinergic receptor muscarinic 5 | 9913 | VGNC:27321 | Inparanoid, OMA |
| Chicken | 428881 | CHRM5 | cholinergic receptor muscarinic 5 | 9031 | CGNC:53502 | Inparanoid, OMA |
| Anole lizard | 100562127 | chrm5 | cholinergic receptor muscarinic 5 | 28377 | Inparanoid, OMA | |
| Xenopus | 100498518 | chrm5 | cholinergic receptor, muscarinic 5 | 8364 | XB-GENE-986590 | Inparanoid, OMA |
| Zebrafish | 553978 | chrm5a | cholinergic receptor, muscarinic 5a | 7955 | ZDB-GENE-080723-32 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Muscarinic acetylcholine receptor M5
protein / receptor / G-protein coupled receptor / Muscarinic acetylcholine receptor M5
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Acetylcholine receptor (muscarinic) / Muscarinic acetylcholine receptor M5
protein / G-protein coupled receptor / Class A rhodopsin like / Acetylcholine receptor (muscarinic) / Muscarinic acetylcholine receptor M5
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.