224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Apelin receptor |
|---|
Gene and Protein Information
| Gene ID | 187 |
|---|---|
| Uniprot Accession IDs | P35414 |
| Ensembl ID | ENSP00000475344 |
| Symbole | AGTRL1 APJ APJ APJR HG11 AGTRL1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466585 | APLNR | apelin receptor | 9598 | VGNC:53053 | OMA, EggNOG |
| Macaque | 706823 | APLNR | apelin receptor | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 23796 | Aplnr | apelin receptor | 10090 | MGI:1346086 | Inparanoid, OMA, EggNOG |
| Rat | 83518 | Aplnr | apelin receptor | 10116 | RGD:621645 | Inparanoid, OMA, EggNOG |
| Dog | 483497 | APLNR | apelin receptor | 9615 | VGNC:37987 | Inparanoid, OMA, EggNOG |
| Horse | 100066889 | APLNR | apelin receptor | 9796 | VGNC:15409 | Inparanoid, OMA, EggNOG |
| Cow | 615435 | APLNR | apelin receptor | 9913 | VGNC:26018 | Inparanoid, OMA, EggNOG |
| Platypus | APLNR | apelin receptor [Source:HGNC Symbol;Acc:HGNC:339] | 9258 | OMA, EggNOG | ||
| Chicken | 429337 | APLNR | apelin receptor | 9031 | CGNC:3593 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568222 | aplnr | apelin receptor | 28377 | OMA, EggNOG | |
| Anole lizard | 100561089 | LOC100561089 | apelin receptor-like | 28377 | Inparanoid, OMA | |
| Zebrafish | 565492 | aplnrb | apelin receptor b | 7955 | ZDB-GENE-050913-90 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Apelin receptor / Apelin receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Apelin receptor / Apelin receptor
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.