Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Apelin receptor |
|---|
Gene and Protein Information
| Gene ID | 187 |
|---|---|
| Uniprot Accession IDs | P35414 |
| Ensembl ID | ENSP00000475344 |
| Symbole | AGTRL1 APJ APJ APJR HG11 AGTRL1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466585 | APLNR | apelin receptor | 9598 | VGNC:53053 | OMA, EggNOG |
| Macaque | 706823 | APLNR | apelin receptor | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 23796 | Aplnr | apelin receptor | 10090 | MGI:1346086 | Inparanoid, OMA, EggNOG |
| Rat | 83518 | Aplnr | apelin receptor | 10116 | RGD:621645 | Inparanoid, OMA, EggNOG |
| Dog | 483497 | APLNR | apelin receptor | 9615 | VGNC:37987 | Inparanoid, OMA, EggNOG |
| Horse | 100066889 | APLNR | apelin receptor | 9796 | VGNC:15409 | Inparanoid, OMA, EggNOG |
| Cow | 615435 | APLNR | apelin receptor | 9913 | VGNC:26018 | Inparanoid, OMA, EggNOG |
| Platypus | APLNR | apelin receptor [Source:HGNC Symbol;Acc:HGNC:339] | 9258 | OMA, EggNOG | ||
| Chicken | 429337 | APLNR | apelin receptor | 9031 | CGNC:3593 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568222 | aplnr | apelin receptor | 28377 | OMA, EggNOG | |
| Anole lizard | 100561089 | LOC100561089 | apelin receptor-like | 28377 | Inparanoid, OMA | |
| Zebrafish | 565492 | aplnrb | apelin receptor b | 7955 | ZDB-GENE-050913-90 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Apelin receptor / Apelin receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Apelin receptor / Apelin receptor
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.