🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

YWHAZ

Description14-3-3 protein zeta/delta

Gene and Protein Information

Gene ID7534
Uniprot Accession IDs P63104 A8K1N0 B7Z465 P29213 P29312 Q32P43 Q5XJ08 Q6GPI2 Q6IN74 Q6NUR9 Q6P3U9 Q86V33
Ensembl ID ENSP00000379287
Symbole HEL4 YWHAD KCIP-1 HEL-S-3 HEL-S-93 14-3-3-zeta
FamilyBelongs to the 14-3-3 family.
Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque709723YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9544Inparanoid, OMA, EggNOG
Mouse22631Ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide10090MGI:109484Inparanoid, OMA, EggNOG
Rat25578Ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta10116RGD:3980Inparanoid, OMA, EggNOG
Dog475864YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9615Inparanoid, OMA, EggNOG
Horse100056060YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9796VGNC:25121Inparanoid, OMA, EggNOG
Cow287022YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9913VGNC:53885Inparanoid, OMA, EggNOG
Pig780440YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9823Inparanoid, OMA, EggNOG
Opossum100030704YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta13616OMA, EggNOG
Platypus100077972YWHAZtyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta9258OMA, EggNOG
Anole lizard100553372ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta28377Inparanoid, OMA
Xenopus394780ywhaztyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta8364XB-GENE-970616Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.