Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Monoacylglycerol lipase ABHD6 |
|---|
Gene and Protein Information
| Gene ID | 57406 |
|---|---|
| Uniprot Accession IDs | Q9BV23 B2R7Y9 Q6ZMF7 |
| Ensembl ID | ENSP00000420315 |
| Family | Belongs to the AB hydrolase superfamily. |
| Sequence | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470830 | ABHD6 | abhydrolase domain containing 6 | 9598 | VGNC:53352 | OMA, EggNOG |
| Macaque | 702384 | ABHD6 | abhydrolase domain containing 6 | 9544 | Inparanoid, OMA | |
| Mouse | 66082 | Abhd6 | abhydrolase domain containing 6 | 10090 | MGI:1913332 | Inparanoid, OMA, EggNOG |
| Rat | 305795 | Abhd6 | abhydrolase domain containing 6 | 10116 | RGD:1359323 | Inparanoid, OMA, EggNOG |
| Dog | 484712 | ABHD6 | abhydrolase domain containing 6 | 9615 | VGNC:37472 | Inparanoid, OMA, EggNOG |
| Horse | 100057821 | ABHD6 | abhydrolase domain containing 6 | 9796 | VGNC:14948 | Inparanoid, OMA |
| Cow | 505283 | ABHD6 | abhydrolase domain containing 6 | 9913 | VGNC:25503 | Inparanoid, OMA, EggNOG |
| Pig | 100515411 | ABHD6 | abhydrolase domain containing 6 | 9823 | Inparanoid, OMA | |
| Opossum | 100014368 | ABHD6 | abhydrolase domain containing 6 | 13616 | Inparanoid, OMA | |
| Platypus | 100093261 | ABHD6 | abhydrolase domain containing 6 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 416009 | ABHD6 | abhydrolase domain containing 6 | 9031 | CGNC:4246 | Inparanoid, OMA, EggNOG |
| Xenopus | 100145783 | abhd6 | abhydrolase domain containing 6 | 8364 | XB-GENE-966285 | Inparanoid, OMA, EggNOG |
| Zebrafish | 799085 | abhd6a | abhydrolase domain containing 6a | 7955 | ZDB-GENE-090925-1 | Inparanoid, OMA |
| S.cerevisiae | 855801 | YNR064C | epoxide hydrolase | 4932 | S000005347 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.