🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

AIF1

DescriptionAllograft inflammatory factor 1

Gene and Protein Information

Gene ID199
Uniprot Accession IDs P55008 A8K406 O43904 Q9UIV4 Q9UKS9 AIF-1
Ensembl ID ENSP00000365227
Symbole G1 IBA1 IBA1 IRT1 AIF-1 IRT-1
Sequence
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Mouse11629Aif1allograft inflammatory factor 110090MGI:1343098Inparanoid, OMA
Rat29427Aif1allograft inflammatory factor 110116RGD:61924Inparanoid, OMA
Dog474841AIF1allograft inflammatory factor 19615VGNC:37735Inparanoid, OMA
Horse100050158AIF1allograft inflammatory factor 19796VGNC:15185Inparanoid, OMA, EggNOG
Cow280989AIF1allograft inflammatory factor 19913VGNC:25759Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Allograft inflammatory factor 1
protein    /    calcium-binding protein    /    annexin    /    Allograft inflammatory factor 1
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Allograft inflammatory factor 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.