🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

HTR3B

Description5-hydroxytryptamine receptor 3B

Gene and Protein Information

Gene ID9177
Uniprot Accession IDs O95264 B0YJ23 Q0VJC3 5-HT3-B
Ensembl ID ENSP00000260191
Symbole 5-HT3B
FamilyBelongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3B sub-subfamily.
Sequence
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp466788HTR3B5-hydroxytryptamine receptor 3B9598VGNC:7502OMA, EggNOG
Macaque694830HTR3B5-hydroxytryptamine receptor 3B9544Inparanoid, OMA, EggNOG
Mouse57014Htr3b5-hydroxytryptamine (serotonin) receptor 3B10090MGI:1861899Inparanoid, OMA, EggNOG
Rat58963Htr3b5-hydroxytryptamine receptor 3B10116RGD:61820Inparanoid, OMA, EggNOG
Dog611236HTR3B5-hydroxytryptamine receptor 3B9615VGNC:41830Inparanoid, OMA, EggNOG
Cow541055HTR3B5-hydroxytryptamine receptor 3B9913VGNC:29999Inparanoid, OMA, EggNOG
Pig100625976HTR3B5-hydroxytryptamine receptor 3B9823Inparanoid, OMA, EggNOG
Opossum100032167HTR3B5-hydroxytryptamine receptor 3B13616Inparanoid, OMA, EggNOG
XenopusHTR3B5-hydroxytryptamine receptor 3B [Source:HGNC Symbol;Acc:HGNC:5298]8364OMA, EggNOG
Zebrafish571632htr3b5-hydroxytryptamine (serotonin) receptor 3B7955ZDB-GENE-071012-4Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    ligand-gated ion channel    /    5-hydroxytryptamine receptor 3B
protein    /    transporter    /    ion channel    /    5-hydroxytryptamine receptor 3B
protein    /    transporter    /    acetylcholine receptor    /    5-hydroxytryptamine receptor 3B
protein    /    transporter    /    GABA receptor    /    5-hydroxytryptamine receptor 3B
protein    /    transporter    /    receptor    /    5-hydroxytryptamine receptor 3B
DTO Classes
protein    /    Ion channel    /    Neurotransmitter receptor, Cys loop, ligand-gated ion channel (LIC) family    /    5-hydroxytryptamine receptor subfamily    /    5-HT3 receptor sub-subfamily    /    5-hydroxytryptamine receptor 3B

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.