🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

SERPINA1

DescriptionAlpha-1-antitrypsin

Gene and Protein Information

Gene ID5265
Uniprot Accession IDs P01009 A6PX14 B2RDQ8 Q0PVP5 Q13672 Q53XB8 Q5U0M1 Q7M4R2 Q86U18 Q86U19 Q96BF9 Q96ES1 Q9P1P0 Q9UCE6 Q9UCM3
Ensembl ID ENSP00000416066
Symbole AAT PI PI A1A AAT PI1 A1AT nNIF PRO2275 alpha1AT
FamilyBelongs to the serpin family.
Sequence
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp467541SERPINA1serpin family A member 19598OMA, EggNOG
Macaque701361SERPINA1serpin family A member 19544Inparanoid, OMA, EggNOG
Mouse20704Serpina1eserine (or cysteine) peptidase inhibitor, clade A, member 1E10090MGI:891967Inparanoid, OMA
Mouse20702Serpina1cserine (or cysteine) peptidase inhibitor, clade A, member 1C10090MGI:891969OMA, EggNOG
Rat24648Serpina1serpin family A member 110116RGD:3326Inparanoid, OMA, EggNOG
Dog480422SERPINA1serpin family A member 19615VGNC:51681Inparanoid, OMA, EggNOG
Horse100065191LOC100065191alpha-1-antiproteinase 2-like9796Inparanoid, OMA
Horse100065068LOC100065068alpha-1-antiproteinase 2-like9796OMA, EggNOG
Cow280699SERPINA1serpin family A member 19913VGNC:53953Inparanoid, OMA, EggNOG
Pig397688SERPINA1serpin family A member 19823Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    Alpha-1-antitrypsin
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    Alpha-1-antitrypsin

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.