Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | 5-hydroxytryptamine receptor 2C |
|---|
Gene and Protein Information
| Gene ID | 3358 |
|---|---|
| Uniprot Accession IDs | P28335 B1AMW4 Q5VUF8 Q9NP28 5-HT-2C |
| Ensembl ID | ENSP00000276198 |
| Symbole | HTR1C HTR1C 5-HT1C 5-HT2C 5HTR2C 5-HTR2C |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 473740 | HTR2C | 5-hydroxytryptamine receptor 2C | 9598 | VGNC:7460 | Inparanoid, OMA, EggNOG |
| Macaque | 708141 | HTR2C | 5-hydroxytryptamine receptor 2C | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15560 | Htr2c | 5-hydroxytryptamine (serotonin) receptor 2C | 10090 | MGI:96281 | Inparanoid, OMA, EggNOG |
| Rat | 25187 | Htr2c | 5-hydroxytryptamine receptor 2C | 10116 | RGD:2848 | Inparanoid, OMA, EggNOG |
| Dog | 450240 | HTR2C | 5-hydroxytryptamine receptor 2C | 9615 | VGNC:41828 | Inparanoid, OMA, EggNOG |
| Horse | 100057852 | HTR2C | 5-hydroxytryptamine receptor 2C | 9796 | VGNC:18905 | Inparanoid, OMA, EggNOG |
| Pig | 100524920 | HTR2C | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011052 | HTR2C | 5-hydroxytryptamine receptor 2C | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100496012 | htr2c | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled | 8364 | XB-GENE-967634 | Inparanoid, OMA |
| Zebrafish | 100000981 | htr2cl1 | 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1 | 7955 | ZDB-GENE-081104-48 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / 5-hydroxytryptamine receptor / 5-HT2 receptor / 5-hydroxytryptamine receptor 2c
protein / G-protein coupled receptor / Class A rhodopsin like / 5-hydroxytryptamine receptor / 5-HT2 receptor / 5-hydroxytryptamine receptor 2c
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.