Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Adenosine receptor A1 |
|---|
Gene and Protein Information
| Gene ID | 134 |
|---|---|
| Uniprot Accession IDs | P30542 A6NFY5 A6NGP4 A8K1L3 B3KXQ4 D2CGD0 Q6FHK3 Q8TAM8 |
| Ensembl ID | ENSP00000356205 |
| Symbole | RDC7 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457638 | ADORA1 | adenosine A1 receptor | 9598 | VGNC:10535 | OMA, EggNOG |
| Macaque | 703638 | ADORA1 | adenosine A1 receptor | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 11539 | Adora1 | adenosine A1 receptor | 10090 | MGI:99401 | Inparanoid, OMA, EggNOG |
| Rat | 29290 | Adora1 | adenosine A1 receptor | 10116 | RGD:2048 | Inparanoid, OMA, EggNOG |
| Dog | 403961 | ADORA1 | adenosine A1 receptor | 9615 | VGNC:37665 | Inparanoid, OMA, EggNOG |
| Horse | 100052496 | ADORA1 | adenosine A1 receptor | 9796 | VGNC:15126 | Inparanoid, OMA, EggNOG |
| Cow | 282133 | ADORA1 | adenosine A1 receptor | 9913 | VGNC:25686 | Inparanoid, OMA |
| Opossum | ADORA1 | adenosine A1 receptor [Source:HGNC Symbol;Acc:HGNC:262] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 374212 | ADORA1 | adenosine A1 receptor | 9031 | CGNC:91 | Inparanoid, OMA, EggNOG |
| Xenopus | 100127730 | adora1 | adenosine A1 receptor | 8364 | XB-GENE-944026 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Adenosine receptor / Adenosine receptor a1
protein / G-protein coupled receptor / Class A rhodopsin like / Adenosine receptor / Adenosine receptor a1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.