🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

ADORA1

DescriptionAdenosine receptor A1

Gene and Protein Information

Gene ID134
Uniprot Accession IDs P30542 A6NFY5 A6NGP4 A8K1L3 B3KXQ4 D2CGD0 Q6FHK3 Q8TAM8
Ensembl ID ENSP00000356205
Symbole RDC7
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457638ADORA1adenosine A1 receptor9598VGNC:10535OMA, EggNOG
Macaque703638ADORA1adenosine A1 receptor9544Inparanoid, OMA, EggNOG
Mouse11539Adora1adenosine A1 receptor10090MGI:99401Inparanoid, OMA, EggNOG
Rat29290Adora1adenosine A1 receptor10116RGD:2048Inparanoid, OMA, EggNOG
Dog403961ADORA1adenosine A1 receptor9615VGNC:37665Inparanoid, OMA, EggNOG
Horse100052496ADORA1adenosine A1 receptor9796VGNC:15126Inparanoid, OMA, EggNOG
Cow282133ADORA1adenosine A1 receptor9913VGNC:25686Inparanoid, OMA
OpossumADORA1adenosine A1 receptor [Source:HGNC Symbol;Acc:HGNC:262]13616Inparanoid, OMA, EggNOG
Chicken374212ADORA1adenosine A1 receptor9031CGNC:91Inparanoid, OMA, EggNOG
Xenopus100127730adora1adenosine A1 receptor8364XB-GENE-944026Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Adenosine receptor a1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Adenosine receptor    /    Adenosine receptor a1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.