224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | HLA class I histocompatibility antigen, A-3 alpha chain |
|---|
Gene and Protein Information
| Gene ID | 3105 |
|---|---|
| Uniprot Accession IDs | P04439 O19546 O19756 Q65A82 Q9GJE6 Q9GJE7 Q9GJE8 Q9MYE6 Q9MYG4 Q9TPR8 |
| Ensembl ID | ENSP00000379873 |
| Symbole | HLAA HLAA |
| Family | Belongs to the MHC class I family. |
| Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 494187 | PATR-G | MHC class Ib | 9598 | OMA, EggNOG | |
| Macaque | 106995876 | LOC106995876 | HLA class I histocompatibility antigen, A-11 alpha chain-like | 9544 | OMA, EggNOG | |
| Rat | 100364500 | LOC100364500 | RT1 class I, locus CE11-like | 10116 | RGD:2320860 | OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.