Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Charged multivesicular body protein 2b |
|---|
Gene and Protein Information
| Gene ID | 25978 |
|---|---|
| Uniprot Accession IDs | Q9UQN3 B4DJG8 Q53HC7 Q9Y4U6 |
| Ensembl ID | ENSP00000263780 |
| Symbole | DMT1 ALS17 VPS2B VPS2-2 CHMP2.5 |
| Family | Belongs to the SNF7 family. |
| Sequence | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 735485 | CHMP2B | charged multivesicular body protein 2B | 9598 | VGNC:1776 | OMA, EggNOG |
| Macaque | 719340 | CHMP2B | charged multivesicular body protein 2B | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 68942 | Chmp2b | charged multivesicular body protein 2B | 10090 | MGI:1916192 | Inparanoid, OMA, EggNOG |
| Rat | 363720 | Chmp2b | charged multivesicular body protein 2B | 10116 | RGD:1306781 | Inparanoid, OMA, EggNOG |
| Dog | 487675 | CHMP2B | charged multivesicular body protein 2B | 9615 | VGNC:39223 | Inparanoid, OMA, EggNOG |
| Horse | 100070130 | CHMP2B | charged multivesicular body protein 2B | 9796 | VGNC:16506 | Inparanoid, OMA, EggNOG |
| Cow | 615954 | CHMP2B | charged multivesicular body protein 2B | 9913 | VGNC:27301 | Inparanoid, OMA, EggNOG |
| Pig | 100516044 | CHMP2B | charged multivesicular body protein 2B | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100030296 | CHMP2B | charged multivesicular body protein 2B | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100084750 | CHMP2B | charged multivesicular body protein 2B | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 418461 | CHMP2B | charged multivesicular body protein 2B | 9031 | CGNC:11553 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552916 | chmp2b | charged multivesicular body protein 2B | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 407966 | chmp2b | charged multivesicular body protein 2B | 8364 | XB-GENE-948820 | Inparanoid, OMA, EggNOG |
| Zebrafish | 405840 | chmp2bb | charged multivesicular body protein 2Bb | 7955 | ZDB-GENE-040426-2539 | Inparanoid, OMA |
| C. elegans | 182050 | C01A2.4 | hypothetical protein | 6239 | Inparanoid, OMA | |
| Fruitfly | 38599 | CHMP2B | Charged multivesicular body protein 2b | 7227 | FBgn0035589 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.