Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Taste receptor type 2 member 60 |
|---|
Gene and Protein Information
| Gene ID | 338398 |
|---|---|
| Uniprot Accession IDs | P59551 A4D2G8 Q645W8 Q7RTR7 T2R60 |
| Ensembl ID | ENSP00000327724 |
| Symbole | T2R56 T2R60 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQAHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSNCRLRAVLKSRRSSRCGTP Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 493890 | TAS2R60 | taste 2 receptor member 60 | 9598 | VGNC:8777 | Inparanoid, OMA, EggNOG |
| Mouse | 387512 | Tas2r135 | taste receptor, type 2, member 135 | 10090 | MGI:2681302 | Inparanoid, OMA, EggNOG |
| Rat | 502757 | Tas2r135 | taste receptor, type 2, member 135 | 10116 | RGD:1561078 | Inparanoid, OMA, EggNOG |
| Pig | 100524179 | TAS2R60 | taste 2 receptor member 60 | 9823 | OMA, EggNOG | |
| Opossum | 664662 | TAS2R60 | taste 2 receptor member 60 | 13616 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 60
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 60
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.