🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

TIMP2

DescriptionMetalloproteinase inhibitor 2

Gene and Protein Information

Gene ID7077
Uniprot Accession IDs P16035 Q16121 Q93006 Q9UDF7
Ensembl ID ENSP00000262768
Symbole DDC8 CSC-21K
FamilyBelongs to the protease inhibitor I35 (TIMP) family.
Sequence
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp743167TIMP2TIMP metallopeptidase inhibitor 29598VGNC:9705OMA, EggNOG
Mouse21858Timp2tissue inhibitor of metalloproteinase 210090MGI:98753Inparanoid, OMA, EggNOG
Rat29543Timp2TIMP metallopeptidase inhibitor 210116RGD:61312Inparanoid, OMA, EggNOG
Dog403633TIMP2TIMP metallopeptidase inhibitor 29615Inparanoid, EggNOG
Horse100034134TIMP2TIMP metallopeptidase inhibitor 29796OMA, EggNOG
Cow282093TIMP2TIMP metallopeptidase inhibitor 29913VGNC:35871Inparanoid, OMA, EggNOG
Pig396988TIMP2TIMP metallopeptidase inhibitor 29823OMA, EggNOG
Opossum100030996TIMP2TIMP metallopeptidase inhibitor 213616Inparanoid, OMA, EggNOG
Chicken374178TIMP2TIMP metallopeptidase inhibitor 29031CGNC:49073Inparanoid, OMA
Anole lizard100566015timp2TIMP metallopeptidase inhibitor 228377Inparanoid, OMA, EggNOG
Xenopus548477timp2TIMP metallopeptidase inhibitor 28364XB-GENE-949671Inparanoid, OMA, EggNOG
Zebrafish359835timp2aTIMP metallopeptidase inhibitor 2a7955ZDB-GENE-030612-1Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.