Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Nucleolysin TIA-1 isoform p40 |
|---|
Gene and Protein Information
| Gene ID | 7072 |
|---|---|
| Uniprot Accession IDs | P31483 Q53SS9 Q96B58 |
| Ensembl ID | ENSP00000401371 |
| Symbole | WDM TIA-1 |
| Sequence | MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459303 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9598 | OMA, EggNOG | |
| Macaque | 702366 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 21841 | Tia1 | cytotoxic granule-associated RNA binding protein 1 | 10090 | MGI:107914 | Inparanoid, OMA, EggNOG |
| Rat | 312510 | Tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 10116 | RGD:1305742 | Inparanoid, OMA |
| Dog | 610625 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9615 | VGNC:47363 | Inparanoid, OMA, EggNOG |
| Horse | TIA1 | TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802] | 9796 | OMA, EggNOG | ||
| Cow | 538533 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9913 | VGNC:35858 | Inparanoid, OMA, EggNOG |
| Opossum | 100032808 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 13616 | Inparanoid, EggNOG | |
| Chicken | 771327 | TIA1 | TIA1 cytotoxic granule associated RNA binding protein | 9031 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394890 | tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 8364 | XB-GENE-1002876 | Inparanoid, OMA, EggNOG |
| Zebrafish | 793165 | tia1 | TIA1 cytotoxic granule-associated RNA binding protein | 7955 | ZDB-GENE-030131-1506 | Inparanoid, OMA, EggNOG |
| C. elegans | 173967 | tiar-1 | TIA-1/TIAL RNA binding protein homolog | 6239 | OMA, EggNOG | |
| S.cerevisiae | 855716 | PUB1 | Pub1p | 4932 | S000004961 | OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.