🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

ATF3

DescriptionCyclic AMP-dependent transcription factor ATF-3

Gene and Protein Information

Gene ID467
Uniprot Accession IDs P18847 Q5VTZ2 Q6ICQ9 Q7Z566 Q8WYM6 cAMP-dependent transcription factor ATF-3
Ensembl ID ENSP00000344352
FamilyBelongs to the bZIP family. ATF subfamily.
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp469143ATF3activating transcription factor 39598VGNC:10546OMA, EggNOG
Macaque710832ATF3activating transcription factor 39544Inparanoid, OMA, EggNOG
Mouse11910Atf3activating transcription factor 310090MGI:109384Inparanoid, OMA, EggNOG
Rat25389Atf3activating transcription factor 310116RGD:2165Inparanoid, OMA, EggNOG
Dog612911ATF3activating transcription factor 39615VGNC:38209Inparanoid, OMA, EggNOG
Horse100050849ATF3activating transcription factor 39796VGNC:15611Inparanoid, OMA, EggNOG
Cow515266ATF3activating transcription factor 39913VGNC:26241Inparanoid, OMA, EggNOG
Pig100738612ATF3activating transcription factor 39823OMA, EggNOG
Opossum100016599ATF3activating transcription factor 313616Inparanoid, OMA, EggNOG
Platypus100075947ATF3activating transcription factor 39258Inparanoid, OMA, EggNOG
Chicken421369ATF3activating transcription factor 39031CGNC:66403Inparanoid, OMA
Anole lizard100566474atf3activating transcription factor 328377Inparanoid, OMA, EggNOG
Xenopus100494437atf3activating transcription factor 38364XB-GENE-6085251Inparanoid, OMA, EggNOG
Zebrafish393939atf3activating transcription factor 37955ZDB-GENE-040426-728Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.