🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

ATG13

DescriptionAutophagy-related protein 13

Gene and Protein Information

Gene ID9776
Uniprot Accession IDs O75143 B4DFI4 D3DQQ1 D3DQQ2 E9PQZ8 Q53EN6 Q9BRL3 Q9H8B0
Ensembl ID ENSP00000432412
Symbole KIAA0652 KIAA0652 PARATARG8
FamilyBelongs to the ATG13 family. Metazoan subfamily.
Sequence
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp451155ATG13autophagy related 139598VGNC:3206Inparanoid, OMA, EggNOG
Macaque714322ATG13autophagy related 139544Inparanoid, OMA
Mouse51897Atg13autophagy related 1310090MGI:1196429Inparanoid, OMA, EggNOG
Rat362164Atg13autophagy related 1310116RGD:1310685Inparanoid, OMA
Dog483632ATG13autophagy related 139615VGNC:38217Inparanoid, OMA, EggNOG
Horse100050734ATG13autophagy related 139796VGNC:15618Inparanoid, OMA, EggNOG
Cow507340ATG13autophagy related 139913VGNC:26251Inparanoid, OMA, EggNOG
Pig100516128ATG13autophagy related 139823Inparanoid, OMA, EggNOG
Opossum100011759ATG13autophagy related 1313616Inparanoid, OMA, EggNOG
Chicken423192ATG13autophagy related 139031CGNC:6324Inparanoid, OMA, EggNOG
Anole lizard100566276atg13autophagy related 1328377Inparanoid, OMA, EggNOG
Xenopus100125026atg13autophagy related 138364XB-GENE-960599Inparanoid, OMA, EggNOG
Zebrafish393405atg13ATG13 autophagy related 13 homolog (S. cerevisiae)7955ZDB-GENE-040426-1149Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.