🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CLIC3

DescriptionChloride intracellular channel protein 3

Gene and Protein Information

Gene ID9022
Uniprot Accession IDs O95833 Q5SPZ7
Ensembl ID ENSP00000419378
FamilyBelongs to the chloride channel CLIC family.
Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp464921CLIC3chloride intracellular channel 39598VGNC:13865OMA, EggNOG
Macaque721634CLIC3chloride intracellular channel 39544Inparanoid, OMA
Mouse69454Clic3chloride intracellular channel 310090MGI:1916704Inparanoid, OMA
Rat296566Clic3chloride intracellular channel 310116RGD:1307249Inparanoid, OMA
Dog607042CLIC3chloride intracellular channel 39615VGNC:39339Inparanoid, OMA, EggNOG
Horse100066181CLIC3chloride intracellular channel 39796VGNC:16612Inparanoid, OMA
Cow505436CLIC3chloride intracellular channel 39913VGNC:27441Inparanoid, OMA, EggNOG
Opossum100022461CLIC3chloride intracellular channel 313616Inparanoid, EggNOG
Platypus100083829CLIC3chloride intracellular channel 39258Inparanoid, OMA
Anole lizard103281557clic3chloride intracellular channel 328377Inparanoid, OMA
Xenopus447989clic3chloride intracellular channel 38364XB-GENE-959390Inparanoid, OMA, EggNOG
Zebrafish84040clic3chloride intracellular channel 37955ZDB-GENE-010507-2OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    Intracellular chloride channel (clic) family    /    Chloride intracellular channel protein 3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.