CISD1

DescriptionCDGSH iron-sulfur domain-containing protein 1

Gene and Protein Information

Gene ID55847
Uniprot Accession IDs Q9NZ45 Q1X902
Ensembl ID ENSP00000363041
Symbole C10orf70 ZCD1 ZCD1 MDS029 C10orf70 mitoNEET
FamilyBelongs to the CISD protein family.
Sequence
MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp748227CISD1CDGSH iron sulfur domain 19598VGNC:51970OMA, EggNOG
Macaque701716CISD1CDGSH iron sulfur domain 19544Inparanoid, OMA, EggNOG
Mouse52637Cisd1CDGSH iron sulfur domain 110090MGI:1261855Inparanoid, OMA, EggNOG
Rat294362Cisd1CDGSH iron sulfur domain 110116RGD:1309529Inparanoid, OMA, EggNOG
Horse100072162CISD1CDGSH iron sulfur domain 19796OMA, EggNOG
Cow531444CISD1CDGSH iron sulfur domain 19913VGNC:27371Inparanoid, OMA, EggNOG
Pig100520401LOC100520401CDGSH iron-sulfur domain-containing protein 19823Inparanoid, OMA, EggNOG
Opossum100024488CISD1CDGSH iron sulfur domain 113616Inparanoid, EggNOG
PlatypusCISD1CDGSH iron sulfur domain 1 [Source:HGNC Symbol;Acc:HGNC:30880]9258OMA, EggNOG
Chicken423642CISD1CDGSH iron sulfur domain 19031CGNC:1950Inparanoid, OMA, EggNOG
Anole lizard100559354cisd1CDGSH iron sulfur domain 128377Inparanoid, OMA, EggNOG
Xenopus448057cisd1CDGSH iron sulfur domain 18364XB-GENE-973366Inparanoid, OMA, EggNOG
Zebrafish393577cisd1CDGSH iron sulfur domain 17955ZDB-GENE-040426-1162Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.