224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | CDGSH iron-sulfur domain-containing protein 1 |
|---|
Gene and Protein Information
| Gene ID | 55847 |
|---|---|
| Uniprot Accession IDs | Q9NZ45 Q1X902 |
| Ensembl ID | ENSP00000363041 |
| Symbole | C10orf70 ZCD1 ZCD1 MDS029 C10orf70 mitoNEET |
| Family | Belongs to the CISD protein family. |
| Sequence | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748227 | CISD1 | CDGSH iron sulfur domain 1 | 9598 | VGNC:51970 | OMA, EggNOG |
| Macaque | 701716 | CISD1 | CDGSH iron sulfur domain 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 52637 | Cisd1 | CDGSH iron sulfur domain 1 | 10090 | MGI:1261855 | Inparanoid, OMA, EggNOG |
| Rat | 294362 | Cisd1 | CDGSH iron sulfur domain 1 | 10116 | RGD:1309529 | Inparanoid, OMA, EggNOG |
| Horse | 100072162 | CISD1 | CDGSH iron sulfur domain 1 | 9796 | OMA, EggNOG | |
| Cow | 531444 | CISD1 | CDGSH iron sulfur domain 1 | 9913 | VGNC:27371 | Inparanoid, OMA, EggNOG |
| Pig | 100520401 | LOC100520401 | CDGSH iron-sulfur domain-containing protein 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024488 | CISD1 | CDGSH iron sulfur domain 1 | 13616 | Inparanoid, EggNOG | |
| Platypus | CISD1 | CDGSH iron sulfur domain 1 [Source:HGNC Symbol;Acc:HGNC:30880] | 9258 | OMA, EggNOG | ||
| Chicken | 423642 | CISD1 | CDGSH iron sulfur domain 1 | 9031 | CGNC:1950 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559354 | cisd1 | CDGSH iron sulfur domain 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448057 | cisd1 | CDGSH iron sulfur domain 1 | 8364 | XB-GENE-973366 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393577 | cisd1 | CDGSH iron sulfur domain 1 | 7955 | ZDB-GENE-040426-1162 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.