Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Actin-related protein 2/3 complex subunit 2 |
|---|
Gene and Protein Information
| Gene ID | 10109 |
|---|---|
| Uniprot Accession IDs | O15144 Q92801 Q9P1D4 |
| Ensembl ID | ENSP00000295685 |
| Symbole | ARC34 ARC34 PRO2446 p34-Arc PNAS-139 |
| Family | Belongs to the ARPC2 family. |
| Sequence | MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459938 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9598 | VGNC:90 | OMA, EggNOG |
| Macaque | 700536 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 76709 | Arpc2 | actin related protein 2/3 complex, subunit 2 | 10090 | MGI:1923959 | Inparanoid, OMA, EggNOG |
| Rat | 301511 | Arpc2 | actin related protein 2/3 complex, subunit 2 | 10116 | RGD:1305848 | Inparanoid, OMA |
| Horse | 100058331 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9796 | VGNC:15537 | Inparanoid, OMA, EggNOG |
| Cow | 540838 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100153175 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011642 | ARPC2 | actin related protein 2/3 complex subunit 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 429041 | ARPC2 | actin related protein 2/3 complex subunit 2 | 9031 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100566658 | arpc2 | actin related protein 2/3 complex subunit 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448094 | arpc2 | actin related protein 2/3 complex subunit 2 | 8364 | XB-GENE-491571 | Inparanoid, OMA, EggNOG |
| Zebrafish | 327068 | arpc2 | actin related protein 2/3 complex, subunit 2 | 7955 | ZDB-GENE-030131-5276 | Inparanoid, OMA, EggNOG |
| C. elegans | 175247 | arx-4 | Probable actin-related protein 2/3 complex subunit 2 | 6239 | Inparanoid, OMA | |
| Fruitfly | 35311 | Arpc2 | Actin-related protein 2/3 complex, subunit 2 | 7227 | FBgn0032859 | Inparanoid, EggNOG |
| S.cerevisiae | 855771 | ARC35 | Arc35p | 4932 | S000005318 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.