Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Carbohydrate sulfotransferase 3 |
|---|
Gene and Protein Information
| Gene ID | 9469 |
|---|---|
| Uniprot Accession IDs | Q7LGC8 O75099 Q52M30 |
| Ensembl ID | ENSP00000362207 |
| Symbole | HSD C6ST C6ST1 |
| Family | Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily. |
| Sequence | MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466290 | CHST3 | carbohydrate sulfotransferase 3 | 9598 | VGNC:12282 | OMA, EggNOG |
| Mouse | 53374 | Chst3 | carbohydrate (chondroitin 6/keratan) sulfotransferase 3 | 10090 | MGI:1858224 | Inparanoid, OMA, EggNOG |
| Rat | 84468 | Chst3 | carbohydrate sulfotransferase 3 | 10116 | RGD:620355 | Inparanoid, OMA, EggNOG |
| Dog | 100855759 | CHST3 | carbohydrate sulfotransferase 3 | 9615 | VGNC:39255 | Inparanoid, OMA, EggNOG |
| Horse | 100063554 | CHST3 | carbohydrate sulfotransferase 3 | 9796 | VGNC:16537 | Inparanoid, OMA, EggNOG |
| Cow | 506758 | CHST3 | carbohydrate sulfotransferase 3 | 9913 | VGNC:27345 | Inparanoid, OMA, EggNOG |
| Pig | 100151968 | CHST3 | carbohydrate sulfotransferase 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010061 | CHST3 | carbohydrate sulfotransferase 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 396018 | CHST3 | carbohydrate sulfotransferase 3 | 9031 | CGNC:49608 | Inparanoid, OMA |
| Anole lizard | 100568098 | chst3 | carbohydrate sulfotransferase 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100492673 | chst3 | carbohydrate (chondroitin 6) sulfotransferase 3 | 8364 | XB-GENE-993289 | OMA, EggNOG |
| Zebrafish | 559721 | chst3a | carbohydrate (chondroitin 6) sulfotransferase 3a | 7955 | ZDB-GENE-090312-180 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.