Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | G-protein coupled bile acid receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 151306 |
|---|---|
| Uniprot Accession IDs | Q8TDU6 B3KV35 |
| Ensembl ID | ENSP00000430886 |
| Symbole | TGR5 BG37 TGR5 M-BAR GPCR19 GPR131 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741111 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9598 | VGNC:50730 | OMA, EggNOG |
| Macaque | 697937 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9544 | Inparanoid, OMA | |
| Mouse | 227289 | Gpbar1 | G protein-coupled bile acid receptor 1 | 10090 | MGI:2653863 | Inparanoid, OMA, EggNOG |
| Rat | 338443 | Gpbar1 | G protein-coupled bile acid receptor 1 | 10116 | RGD:631400 | Inparanoid, OMA |
| Horse | 100055590 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9796 | VGNC:18482 | Inparanoid, OMA, EggNOG |
| Cow | 317756 | GPBAR1 | G protein-coupled bile acid receptor 1 | 9913 | VGNC:29521 | Inparanoid, OMA, EggNOG |
| Opossum | 100011968 | GPBAR1 | G protein-coupled bile acid receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100566467 | gpbar1 | G protein-coupled bile acid receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100488432 | gpbar1 | G protein-coupled bile acid receptor 1 | 8364 | XB-GENE-959591 | Inparanoid, OMA, EggNOG |
| Zebrafish | 797190 | gpbar1 | G protein-coupled bile acid receptor 1 | 7955 | ZDB-GENE-120315-1 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
protein / receptor / G-protein coupled receptor / G-protein coupled bile acid receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Bile acid receptor / G-protein coupled bile acid receptor 1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.