GPBAR1

DescriptionG-protein coupled bile acid receptor 1

Gene and Protein Information

Gene ID151306
Uniprot Accession IDs Q8TDU6 B3KV35
Ensembl ID ENSP00000430886
Symbole TGR5 BG37 TGR5 M-BAR GPCR19 GPR131
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp741111GPBAR1G protein-coupled bile acid receptor 19598VGNC:50730OMA, EggNOG
Macaque697937GPBAR1G protein-coupled bile acid receptor 19544Inparanoid, OMA
Mouse227289Gpbar1G protein-coupled bile acid receptor 110090MGI:2653863Inparanoid, OMA, EggNOG
Rat338443Gpbar1G protein-coupled bile acid receptor 110116RGD:631400Inparanoid, OMA
Horse100055590GPBAR1G protein-coupled bile acid receptor 19796VGNC:18482Inparanoid, OMA, EggNOG
Cow317756GPBAR1G protein-coupled bile acid receptor 19913VGNC:29521Inparanoid, OMA, EggNOG
Opossum100011968GPBAR1G protein-coupled bile acid receptor 113616Inparanoid, OMA, EggNOG
Anole lizard100566467gpbar1G protein-coupled bile acid receptor 128377Inparanoid, OMA, EggNOG
Xenopus100488432gpbar1G protein-coupled bile acid receptor 18364XB-GENE-959591Inparanoid, OMA, EggNOG
Zebrafish797190gpbar1G protein-coupled bile acid receptor 17955ZDB-GENE-120315-1OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled bile acid receptor 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Bile acid receptor    /    G-protein coupled bile acid receptor 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.