Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Endothelin-1 receptor |
|---|
Gene and Protein Information
| Gene ID | 1909 |
|---|---|
| Uniprot Accession IDs | P25101 B2R723 B4E2V6 B7Z9G6 D3DP03 E7ER36 O43441 Q16432 Q16433 Q8TBH2 |
| Ensembl ID | ENSP00000315011 |
| Symbole | ETA ETRA ETA ET-A ETAR ETRA MFDA ETA-R hET-AR |
| Family | Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily. |
| Sequence | METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461530 | EDNRA | endothelin receptor type A | 9598 | VGNC:594 | OMA, EggNOG |
| Macaque | 704135 | EDNRA | endothelin receptor type A | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13617 | Ednra | endothelin receptor type A | 10090 | MGI:105923 | Inparanoid, OMA, EggNOG |
| Rat | 24326 | Ednra | endothelin receptor type A | 10116 | RGD:2535 | Inparanoid, OMA, EggNOG |
| Dog | 450187 | EDNRA | endothelin receptor type A | 9615 | VGNC:40202 | Inparanoid, OMA, EggNOG |
| Horse | 100062644 | EDNRA | endothelin receptor type A | 9796 | VGNC:17424 | Inparanoid, OMA, EggNOG |
| Cow | 281749 | EDNRA | endothelin receptor type A | 9913 | VGNC:28329 | Inparanoid, OMA, EggNOG |
| Pig | 397457 | EDNRA | endothelin receptor type A | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018535 | EDNRA | endothelin receptor type A | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079418 | EDNRA | endothelin receptor type A | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 373908 | EDNRA | endothelin receptor type A | 9031 | CGNC:7610 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559070 | ednra | endothelin receptor type A | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779728 | ednra | endothelin receptor type A | 8364 | XB-GENE-1006994 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114550 | ednraa | endothelin receptor type Aa | 7955 | ZDB-GENE-010906-2 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Endothelin receptor / Endothelin type A / Endothelin-1 receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Endothelin receptor / Endothelin type A / Endothelin-1 receptor
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.