HCAR3

DescriptionHydroxycarboxylic acid receptor 3

Gene and Protein Information

Gene ID8843
Uniprot Accession IDs P49019 A8K4G5 B2R830 E9PI97 Q8NGE4
Ensembl ID ENSP00000436714
Symbole GPR109B HCA3 HM74B NIACR2 HCA3 HM74 PUMAG Puma-g GPR109B
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp452411HCAR3hydroxycarboxylic acid receptor 39598VGNC:13105OMA, EggNOG
Mouse80885Hcar2hydroxycarboxylic acid receptor 210090MGI:1933383Inparanoid, OMA, EggNOG
Rat353250Hcar2hydroxycarboxylic acid receptor 210116RGD:727952Inparanoid, OMA, EggNOG
Opossum100022273LOC100022273hydroxycarboxylic acid receptor 213616Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Hydroxycarboxylic acid receptor    /    Hydroxycarboxylic acid receptor 3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.