🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

GLUL

DescriptionGlutamine synthetase

Gene and Protein Information

Gene ID2752
Uniprot Accession IDs P15104 Q499Y9 Q5T9Z1 Q7Z3W4 Q8IZ17 GS
Ensembl ID ENSP00000307900
Symbole GLNS GS GLNS PIG43 PIG59
FamilyBelongs to the glutamine synthetase family.
Sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp456450GLULglutamate-ammonia ligase9598VGNC:11441OMA, EggNOG
Macaque715952GLULglutamate-ammonia ligase9544Inparanoid, OMA, EggNOG
Mouse14645Glulglutamate-ammonia ligase (glutamine synthetase)10090MGI:95739Inparanoid, OMA, EggNOG
Rat24957Glulglutamate-ammonia ligase10116RGD:2710Inparanoid, OMA, EggNOG
Dog403443GLULglutamate-ammonia ligase9615Inparanoid, OMA, EggNOG
Horse100054716GLULglutamate-ammonia ligase9796VGNC:18397Inparanoid, OMA, EggNOG
Cow281199GLULglutamate-ammonia ligase9913VGNC:29426Inparanoid, OMA, EggNOG
Pig396944GLULglutamate-ammonia ligase9823Inparanoid, OMA, EggNOG
Opossum100017907GLULglutamate-ammonia ligase13616Inparanoid, OMA, EggNOG
Platypus100081935GLULglutamate-ammonia ligase9258Inparanoid, OMA, EggNOG
Anole lizard100561986glulglutamate-ammonia ligase28377Inparanoid, OMA, EggNOG
Xenopus394915glulglutamate-ammonia ligase8364XB-GENE-5923225Inparanoid, EggNOG
Zebrafish100000775glulaglutamate-ammonia ligase (glutamine synthase) a7955ZDB-GENE-030131-688Inparanoid, OMA
C. elegans178452gln-3GLutamiNe synthetase (glutamate-ammonia ligase)6239Inparanoid, OMA
Fruitfly32087Gs2Glutamine synthetase 27227FBgn0001145Inparanoid, EggNOG
S.cerevisiae856147GLN1glutamate--ammonia ligase4932S000006239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.