Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Interferon regulatory factor 8 |
|---|
Gene and Protein Information
| Gene ID | 3394 |
|---|---|
| Uniprot Accession IDs | Q02556 A0AV82 IRF-8 |
| Ensembl ID | ENSP00000268638 |
| Symbole | ICSBP1 ICSBP IRF-8 ICSBP1 IMD32A IMD32B H-ICSBP |
| Family | Belongs to the IRF family. |
| Sequence | MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454294 | IRF8 | interferon regulatory factor 8 | 9598 | VGNC:5813 | OMA, EggNOG |
| Macaque | 693933 | IRF8 | interferon regulatory factor 8 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15900 | Irf8 | interferon regulatory factor 8 | 10090 | MGI:96395 | Inparanoid, OMA, EggNOG |
| Rat | 292060 | Irf8 | interferon regulatory factor 8 | 10116 | RGD:1312024 | Inparanoid, OMA, EggNOG |
| Dog | 489673 | IRF8 | interferon regulatory factor 8 | 9615 | VGNC:42096 | Inparanoid, OMA, EggNOG |
| Horse | 100056218 | IRF8 | interferon regulatory factor 8 | 9796 | VGNC:19138 | Inparanoid, OMA, EggNOG |
| Cow | 614909 | IRF8 | interferon regulatory factor 8 | 9913 | VGNC:30279 | Inparanoid, OMA, EggNOG |
| Opossum | IRF8 | interferon regulatory factor 8 [Source:HGNC Symbol;Acc:HGNC:5358] | 13616 | Inparanoid, EggNOG | ||
| Platypus | 100076859 | IRF8 | interferon regulatory factor 8 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 396385 | IRF8 | interferon regulatory factor 8 | 9031 | CGNC:49782 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100551828 | irf8 | interferon regulatory factor 8 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100496217 | irf8 | interferon regulatory factor 8 | 8364 | XB-GENE-985946 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436895 | irf8 | interferon regulatory factor 8 | 7955 | ZDB-GENE-040718-367 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.