🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

HDAC3

DescriptionHistone deacetylase 3

Gene and Protein Information

Gene ID8841
Uniprot Accession IDs O15379 D3DQE1 O43268 Q9UEI5 Q9UEV0 HD3
Ensembl ID ENSP00000302967
Symbole HD3 RPD3 KDAC3 RPD3-2
FamilyBelongs to the histone deacetylase family. HD type 1 subfamily.
Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp738624HDAC3histone deacetylase 39598VGNC:4032OMA, EggNOG
Macaque704467HDAC3histone deacetylase 39544Inparanoid, OMA, EggNOG
Mouse15183Hdac3histone deacetylase 310090MGI:1343091Inparanoid, OMA, EggNOG
Rat84578Hdac3histone deacetylase 310116RGD:619977Inparanoid, OMA
Dog478040HDAC3histone deacetylase 39615VGNC:50628Inparanoid, OMA, EggNOG
Horse100061405HDAC3histone deacetylase 39796VGNC:49121Inparanoid, OMA, EggNOG
Pig100511372HDAC3histone deacetylase 39823Inparanoid, OMA, EggNOG
Opossum100022921HDAC3histone deacetylase 313616Inparanoid, EggNOG
Chicken395506HDAC3histone deacetylase 39031CGNC:1896Inparanoid, OMA, EggNOG
Anole lizard100557493hdac3histone deacetylase 328377Inparanoid, OMA, EggNOG
Xenopus549637hdac3histone deacetylase 38364XB-GENE-481106Inparanoid, OMA, EggNOG
Zebrafish393965hdac3histone deacetylase 37955ZDB-GENE-040426-847Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    reductase    /    Histone deacetylase 3
protein    /    hydrolase    /    deacetylase    /    Histone deacetylase 3
protein    /    hydrolase    /    nucleic acid binding    /    Histone deacetylase 3
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class I    /    Histone deacetylase 3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.