🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

IMPA1

DescriptionInositol monophosphatase 1

Gene and Protein Information

Gene ID3612
Uniprot Accession IDs P29218 B2R733 B4DLN3 B7Z6Q4 J3KQT7 Q9UK71 IMP 1
Ensembl ID ENSP00000408526
Symbole IMPA IMP IMPA MRT59
FamilyBelongs to the inositol monophosphatase superfamily.
Sequence
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp100613673IMPA1inositol monophosphatase 19598VGNC:12290OMA, EggNOG
Macaque701959IMPA1inositol monophosphatase 19544Inparanoid, OMA, EggNOG
Mouse55980Impa1inositol (myo)-1(or 4)-monophosphatase 110090MGI:1933158Inparanoid, OMA, EggNOG
Rat83523Impa1inositol monophosphatase 110116RGD:69254Inparanoid, OMA, EggNOG
Dog477925IMPA1inositol monophosphatase 19615VGNC:42007Inparanoid, OMA, EggNOG
Horse100050326IMPA1inositol monophosphatase 19796VGNC:19049Inparanoid, OMA, EggNOG
Cow281865IMPA1inositol monophosphatase 19913VGNC:30184Inparanoid, OMA, EggNOG
Pig397425IMPA1inositol monophosphatase 19823Inparanoid, EggNOG
Opossum100019291IMPA1inositol monophosphatase 113616Inparanoid, OMA, EggNOG
Anole lizard100554351impa1inositol monophosphatase 128377Inparanoid, OMA
Xenopus549811impa1inositol(myo)-1(or 4)-monophosphatase 18364XB-GENE-1004318Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.