🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PAK2

DescriptionSerine/threonine-protein kinase PAK 2

Gene and Protein Information

Gene ID5062
Uniprot Accession IDs Q13177 Q13154 Q6ISC3
Ensembl ID ENSP00000314067
Symbole PAK65 PAKgamma
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp460965PAK2p21 (RAC1) activated kinase 29598VGNC:14627OMA, EggNOG
Macaque710314PAK2p21 (RAC1) activated kinase 29544Inparanoid, OMA, EggNOG
Mouse224105Pak2p21 (RAC1) activated kinase 210090MGI:1339984Inparanoid, OMA, EggNOG
Rat29432Pak2p21 (RAC1) activated kinase 210116RGD:61953Inparanoid, OMA, EggNOG
Dog612814PAK2p21 (RAC1) activated kinase 29615VGNC:53081Inparanoid, OMA, EggNOG
Horse100060183PAK2p21 (RAC1) activated kinase 29796Inparanoid, OMA, EggNOG
Cow513673PAK2p21 (RAC1) activated kinase 29913VGNC:53593Inparanoid, OMA, EggNOG
Pig100511837PAK2p21 (RAC1) activated kinase 29823Inparanoid, OMA, EggNOG
Opossum100015796PAK2p21 (RAC1) activated kinase 213616Inparanoid, OMA, EggNOG
Chicken424860PAK2p21 (RAC1) activated kinase 29031CGNC:4842Inparanoid, OMA
Anole lizard100561625pak2p21 (RAC1) activated kinase 228377Inparanoid, OMA
Xenopus733718pak2p21 protein (Cdc42/Rac)-activated kinase 28364XB-GENE-966302Inparanoid, OMA
Zebrafish266749pak2ap21 protein (Cdc42/Rac)-activated kinase 2a7955ZDB-GENE-021011-2Inparanoid, OMA
C. elegans180873pak-1Serine/threonine-protein kinase pak-16239Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    PAKA subfamily    /    Serine/threonine-protein kinase pak 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.