🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PAK3

DescriptionSerine/threonine-protein kinase PAK 3

Gene and Protein Information

Gene ID5063
Uniprot Accession IDs O75914 A8K389 B1GX77 B1GX78 B1GX79 Q5JWX1 Q5JWX2 Q7Z2D6 Q7Z2E4 Q7Z3Z8 Q8WWK5 Q8WX23 Q9P0J8
Ensembl ID ENSP00000353864
Symbole OPHN3 ARA bPAK MRX30 MRX47 OPHN3 PAK-3 PAK3beta beta-PAK
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp450118PAK3p21 (RAC1) activated kinase 39598VGNC:10463Inparanoid, OMA, EggNOG
Mouse18481Pak3p21 (RAC1) activated kinase 310090MGI:1339656Inparanoid, OMA, EggNOG
Rat29433Pak3p21 (RAC1) activated kinase 310116RGD:3251Inparanoid, OMA
Dog492067PAK3p21 (RAC1) activated kinase 39615VGNC:53550Inparanoid, OMA, EggNOG
Horse100054315PAK3p21 (RAC1) activated kinase 39796Inparanoid, OMA, EggNOG
Cow534526PAK3p21 (RAC1) activated kinase 39913VGNC:53659Inparanoid, OMA, EggNOG
Opossum100012727PAK3p21 (RAC1) activated kinase 313616Inparanoid, OMA, EggNOG
Platypus100073584PAK3p21 (RAC1) activated kinase 39258Inparanoid, OMA, EggNOG
Chicken422342PAK3p21 (RAC1) activated kinase 39031CGNC:6100Inparanoid, OMA
Anole lizard100552681pak3p21 (RAC1) activated kinase 328377Inparanoid, OMA
Xenopus100495025pak3p21 protein (Cdc42/Rac)-activated kinase 38364XB-GENE-961764Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    PAKA subfamily    /    Serine/threonine-protein kinase pak 3

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.