🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

P2RY12

DescriptionP2Y purinoceptor 12

Gene and Protein Information

Gene ID64805
Uniprot Accession IDs Q9H244 D3DNJ5 Q546J7 P2Y12
Ensembl ID ENSP00000307259
Symbole HORK3 HORK3 P2Y12 ADPG-R BDPLT8 SP1999 P2T(AC) P2Y(AC) P2Y(12)R P2Y(ADP) P2Y(cyc)
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque710036P2RY12purinergic receptor P2Y129544Inparanoid, OMA, EggNOG
Mouse70839P2ry12purinergic receptor P2Y, G-protein coupled 1210090MGI:1918089Inparanoid, OMA, EggNOG
Rat64803P2ry12purinergic receptor P2Y1210116RGD:621681Inparanoid, OMA, EggNOG
Dog442958P2RY12purinergic receptor P2Y129615VGNC:44214Inparanoid, OMA, EggNOG
Horse100630046P2RY12purinergic receptor P2Y129796VGNC:21110Inparanoid, OMA, EggNOG
Cow408007P2RY12purinergic receptor P2Y129913VGNC:32525Inparanoid, OMA, EggNOG
Pig503659P2RY12purinergic receptor P2Y129823OMA, EggNOG
Opossum100618708P2RY12purinergic receptor P2Y1213616Inparanoid, OMA, EggNOG
Platypus100682030P2RY12purinergic receptor P2Y129258Inparanoid, OMA, EggNOG
Anole lizard103278184p2ry12purinergic receptor P2Y1228377Inparanoid, OMA
Xenopus100493410p2ry12purinergic receptor P2Y, G-protein coupled, 128364XB-GENE-947453Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    P2y purinoceptor 12
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2y purinoceptor 12

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.